CHML Antibody - N-terminal region (AVARP13012_P050)

• Product Number: AVARP13012_P050
• Name: CHML Antibody - N-terminal region (AVARP13012_P050)
• Protein Size (# AA): 656 amino acids
• Molecular Weight: 74kDa
• NCBI Gene Id: 1122
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Choroideremia-like (Rab escort protein 2)
• Alias Symbols: REP2
• Peptide Sequence: Synthetic peptide located within the following region: NPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: van et al., (1994) Hum. Mol. Genet. 3 (7), 1041-1046
• Description of Target: The product of the CHML gene supports geranylgeranylation of most Rab proteins and may substitute for REP-1 in tissues other than retina. CHML is localized close to the gene for Usher syndrome type II.
• Protein Interactions: UBC; RAB6A; RAB5A; RAB1A; RAB3A; RABGGTB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CHML (AVARP13012_P050) antibody is Catalog # AAP30667 (Previous Catalog # AAPP01324)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHML
• Uniprot ID: P26374
• Protein Name: Rab proteins geranylgeranyltransferase component A 2
• Protein Accession #: NP_001812
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001821
• Tested Species Reactivity: Human
• Gene Symbol: CHML
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CHML Antibody Titration: 0.05ug/ml
  Positive Control: Jurkat cell lysate