Product Number |
AVARP09055_T100 |
Product Page |
www.avivasysbio.com/appd-antibody-c-terminal-region-avarp09055-t100.html |
Name |
APPD Antibody - C-terminal region (AVARP09055_T100) |
Protein Size (# AA) |
279 amino acids |
Molecular Weight |
31kDa |
NCBI Gene Id |
79156 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Pleckstrin homology domain containing, family F (with FYVE domain) member 1 |
Alias Symbols |
APPD, LAPF, PHAFIN1, ZFYVE15 |
Peptide Sequence |
Synthetic peptide located within the following region: QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg, R.L., et al (2002) Proc. Natl. Acad. Sci. U.S.A. 99:16899-16903. |
Description of Target |
APPD (Apoptosis-inducing protein D; phafin 1) is predicted through gene annotation and contains pleckstrin homology domain. It may binds to two Zn++ ions through its FYVE zinc finger domain. Biological function of this protein has not been clearly mapped yet. |
Protein Interactions |
L3MBTL3; UBC; KIAA1279; TNNT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PLEKHF1 (AVARP09055_T100) antibody |
Blocking Peptide |
For anti-PLEKHF1 (AVARP09055_T100) antibody is Catalog # AAP30553 (Previous Catalog # AAPP01205) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human APPD |
Uniprot ID |
Q96K11 |
Protein Name |
Pleckstrin homology domain-containing family F member 1 |
Protein Accession # |
NP_077286 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_024310 |
Tested Species Reactivity |
Human |
Gene Symbol |
PLEKHF1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 100% |
Image 1 | Human Jurkat Whole cell
| Host: Rabbit Target Name: APPD Sample Tissue: Human Jurkat Whole cell Antibody Dilution: 1ug/ml |
|