APPD Antibody - C-terminal region (AVARP09055_T100)

Data Sheet
 
Product Number AVARP09055_T100
Product Page www.avivasysbio.com/appd-antibody-c-terminal-region-avarp09055-t100.html
Name APPD Antibody - C-terminal region (AVARP09055_T100)
Protein Size (# AA) 279 amino acids
Molecular Weight 31kDa
NCBI Gene Id 79156
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Pleckstrin homology domain containing, family F (with FYVE domain) member 1
Alias Symbols APPD, LAPF, PHAFIN1, ZFYVE15
Peptide Sequence Synthetic peptide located within the following region: QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg, R.L., et al (2002) Proc. Natl. Acad. Sci. U.S.A. 99:16899-16903.
Description of Target APPD (Apoptosis-inducing protein D; phafin 1) is predicted through gene annotation and contains pleckstrin homology domain. It may binds to two Zn++ ions through its FYVE zinc finger domain. Biological function of this protein has not been clearly mapped yet.
Protein Interactions L3MBTL3; UBC; KIAA1279; TNNT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PLEKHF1 (AVARP09055_T100) antibody
Blocking Peptide For anti-PLEKHF1 (AVARP09055_T100) antibody is Catalog # AAP30553 (Previous Catalog # AAPP01205)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human APPD
Uniprot ID Q96K11
Protein Name Pleckstrin homology domain-containing family F member 1
Protein Accession # NP_077286
Purification Protein A purified
Nucleotide Accession # NM_024310
Tested Species Reactivity Human
Gene Symbol PLEKHF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 100%
Image 1
Human Jurkat Whole cell
Host: Rabbit
Target Name: APPD
Sample Tissue: Human Jurkat Whole cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com