SFRP1 Antibody - middle region (AVARP09053_T100)

Data Sheet
 
Product Number AVARP09053_T100
Product Page www.avivasysbio.com/sfrp1-antibody-middle-region-avarp09053-t100.html
Name SFRP1 Antibody - middle region (AVARP09053_T100)
Protein Size (# AA) 314 amino acids
Molecular Weight 35kDa
NCBI Gene Id 6422
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Secreted frizzled-related protein 1
Alias Symbols FRP, FRP1, FrzA, FRP-1, SARP2
Peptide Sequence Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Secreted frizzled-related protein 1 (SFRP1) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP1 may be involved in de
Protein Interactions KIAA1522; PPP1CC; PPP1CA; WNT4; FZD6; WNT1; WNT2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SFRP1 (AVARP09053_T100) antibody
Blocking Peptide For anti-SFRP1 (AVARP09053_T100) antibody is Catalog # AAP30608 (Previous Catalog # AAPP01261)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SFRP1
Uniprot ID Q8N474
Protein Name Secreted frizzled-related protein 1
Publications

Qiu, Y. et al. Involvement of genetic instability in the downregulation of sFRP1 in Chinese patients with hepatocellular carcinoma. Anat. Rec. (Hoboken). 293, 2020-6 (2010). 21046672

Protein Accession # NP_003003
Purification Protein A purified
Nucleotide Accession # NM_003012
Tested Species Reactivity Human
Gene Symbol SFRP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human kidney
WB Suggested Anti-SFRP1 Antibody Titration: 0.3ug/ml
ELISA Titer: 1:62500
Positive Control: Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com