Product Number |
AVARP09053_T100 |
Product Page |
www.avivasysbio.com/sfrp1-antibody-middle-region-avarp09053-t100.html |
Name |
SFRP1 Antibody - middle region (AVARP09053_T100) |
Protein Size (# AA) |
314 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
6422 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Secreted frizzled-related protein 1 |
Alias Symbols |
FRP, FRP1, FrzA, FRP-1, SARP2 |
Peptide Sequence |
Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Secreted frizzled-related protein 1 (SFRP1) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP1 may be involved in de |
Protein Interactions |
KIAA1522; PPP1CC; PPP1CA; WNT4; FZD6; WNT1; WNT2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SFRP1 (AVARP09053_T100) antibody |
Blocking Peptide |
For anti-SFRP1 (AVARP09053_T100) antibody is Catalog # AAP30608 (Previous Catalog # AAPP01261) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SFRP1 |
Uniprot ID |
Q8N474 |
Protein Name |
Secreted frizzled-related protein 1 |
Publications |
Qiu, Y. et al. Involvement of genetic instability in the downregulation of sFRP1 in Chinese patients with hepatocellular carcinoma. Anat. Rec. (Hoboken). 293, 2020-6 (2010). 21046672 |
Protein Accession # |
NP_003003 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003012 |
Tested Species Reactivity |
Human |
Gene Symbol |
SFRP1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Human kidney
| WB Suggested Anti-SFRP1 Antibody Titration: 0.3ug/ml ELISA Titer: 1:62500 Positive Control: Human kidney |
|