BCL2A1 Antibody - C-terminal region (AVARP09047_P050)

Data Sheet
 
Product Number AVARP09047_P050
Product Page www.avivasysbio.com/bcl2a1-antibody-c-terminal-region-avarp09047-p050.html
Name BCL2A1 Antibody - C-terminal region (AVARP09047_P050)
Protein Size (# AA) 175 amino acids
Molecular Weight 20kDa
NCBI Gene Id 597
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name BCL2-related protein A1
Alias Symbols GRS, ACC1, ACC2, BFL1, ACC-1, ACC-2, HBPA1, BCL2L5
Peptide Sequence Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kunter,U., et al., (2005) Kidney Int. 68 (4), 1520-1532
Description of Target BCL2A1s a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and has been shown to be up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival.
Protein Interactions FAM9B; NR4A1; BIK; BAK1; APP; HAT1; BBC3; PMAIP1; BOK; BCL2L11; HRK; BAD; BID; BAX; GRB2; BMF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BCL2A1 (AVARP09047_P050) antibody
Blocking Peptide For anti-BCL2A1 (AVARP09047_P050) antibody is Catalog # AAP30560 (Previous Catalog # AAPP01212)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BCL2A1
Uniprot ID Q16548
Protein Name Bcl-2-related protein A1
Protein Accession # NP_004040
Purification Affinity Purified
Nucleotide Accession # NM_004049
Tested Species Reactivity Human
Gene Symbol BCL2A1
Predicted Species Reactivity Rat, Dog, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 90%; Pig: 85%; Rat: 78%
Image 1
Human Jurkat
WB Suggested Anti-BCL2A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com