PDCD4 antibody - N-terminal region (AVARP09045_T100)
Data Sheet
 
Product Number AVARP09045_T100
Product Page http://www.avivasysbio.com/pdcd4-antibody-n-terminal-region-avarp09045-t100.html
Product Name PDCD4 antibody - N-terminal region (AVARP09045_T100)
Size 100ug
Gene Symbol PDCD4
Alias Symbols H731
Nucleotide Accession# NM_014456
Protein Size (# AA) 469 amino acids
Molecular Weight 52kDa
Product Format Lyophilized powder
NCBI Gene Id 27250
Host Rabbit
Clonality Polyclonal
Purification Protein A purified
Official Gene Full Name Programmed cell death 4 (neoplastic transformation inhibitor)
Description This is a rabbit polyclonal antibody against PDCD4. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Key Reference Yang,H.S., et al., (2006) Mol. Cell. Biol. 26 (4), 1297-1306
Partner Proteins BAD, BBC3, BID, BIK, HRK, PMAIP1, BAD, BAK1, BAX, BBC3, BCL2L11, BID, BIK, BOK, GRB2, HRK, PMAIP1, BAD, BAX, BCL2L11, BID, BIK, BMF, BOK, Bcl2l11, HRK, PMAIP1
Description of Target PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.
Blocking Peptide For anti-PDCD4 antibody is Catalog # AAP30594
Immunogen The immunogen for anti-PDCD4 antibody: synthetic peptide directed towards the N terminal of human PDCD4
Complete computational species homology data PDCD4 antibody - N-terminal region (AVARP09045_T100)
Lead Time Domestic: within 24 hours delivery   International: 3-5 business days
Tissue Tool Find tissues and cell lines supported to express PDCD4.
Peptide Sequence Synthetic peptide located within the following region: MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKR
Reconstitution and Storage Add 100 ul of distilled water. Final anti-PDCD4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Swissprot Id O15501
Protein Name Programmed cell death protein 4
Protein Accession # NP_055271
Species Reactivity Bovine, Dog, Goat, Guinea pig, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence Bovine: 100%; Dog: 100%; Goat: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Application WB
Image 1
Human Jurkat
WB Suggested Anti-PDCD4 Antibody
Titration: 10 ug/ml
Positive Control: Jurkat Whole Cell
Image 2
Hum. Fetal Heart

Host: Rabbit
Target Name: PDCD4
Sample Tissue: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.

__________________________________________________________________________________________________________________________________________________________________

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com