website statistics
Product Datasheet: AVARP09045_T100 - PDCD4 antibody - N-terminal region (AVARP09045_T100) - Aviva Systems Biology
PDCD4 antibody - N-terminal region (AVARP09045_T100)
Data Sheet
Product Number AVARP09045_T100
Product Page
Product Name PDCD4 antibody - N-terminal region (AVARP09045_T100)
Size 100 ul
Gene Symbol PDCD4
Alias Symbols H731
Protein Size (# AA) 469 amino acids
Molecular Weight 52kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 27250
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Programmed cell death 4 (neoplastic transformation inhibitor)
Description This is a rabbit polyclonal antibody against PDCD4. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKR
Target Reference Yang,H.S., et al., (2006) Mol. Cell. Biol. 26 (4), 1297-1306
Description of Target PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days

*** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
Blocking Peptide For anti-PDCD4 (AVARP09045_T100) antibody is Catalog # AAP30594
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDCD4
Complete computational species homology data Anti-PDCD4 (AVARP09045_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PDCD4.
Swissprot Id O15501
Protein Name Programmed cell death protein 4
Protein Accession # NP_055271
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PDCD4.
Nucleotide Accession # NM_014456
Species Reactivity Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-PDCD4 Antibody
Titration: 10 ug/ml
Positive Control: Jurkat Whole Cell
Image 2
Human Fetal Heart

Host: Rabbit
Target Name: PDCD4
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.


5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |