PDCD4 antibody - N-terminal region (AVARP09045_T100)
Data Sheet
Product Number AVARP09045_T100
Product Page www.avivasysbio.com/pdcd4-antibody-n-terminal-region-avarp09045-t100.html
Product Name PDCD4 antibody - N-terminal region (AVARP09045_T100)
Size 100 ul
Gene Symbol PDCD4
Alias Symbols H731
Protein Size (# AA) 469 amino acids
Molecular Weight 52kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 27250
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Programmed cell death 4 (neoplastic transformation inhibitor)
Description This is a rabbit polyclonal antibody against PDCD4. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKR
Target Reference Yang,H.S., et al., (2006) Mol. Cell. Biol. 26 (4), 1297-1306
Description of Target PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-PDCD4 (AVARP09045_T100) antibody is Catalog # AAP30594
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDCD4
Complete computational species homology data Anti-PDCD4 (AVARP09045_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PDCD4.
Swissprot Id O15501
Protein Name Programmed cell death protein 4
Protein Accession # NP_055271
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PDCD4.
Nucleotide Accession # NM_014456
Replacement Item This antibody may replace item sc-130545 from Santa Cruz Biotechnology.
Conjugation Options

AVARP09045_T100-FITC Conjugated

AVARP09045_T100-HRP Conjugated

AVARP09045_T100-Biotin Conjugated

CB Replacement sc-130545; sc-27122; sc-27123; sc-292504; sc-376430
Species Reactivity Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-PDCD4 Antibody
Titration: 10 ug/ml
Positive Control: Jurkat Whole Cell
Image 2
Human Fetal Heart

Host: Rabbit
Target Name: PDCD4
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com