EIF2AK2 antibody - C-terminal region (AVARP09033_P050)
Data Sheet
 
Product Number AVARP09033_P050
Product Page www.avivasysbio.com/eif2ak2-antibody-c-terminal-region-avarp09033-p050.html
Product Name EIF2AK2 antibody - C-terminal region (AVARP09033_P050)
Size 100 ul
Gene Symbol EIF2AK2
Alias Symbols EIF2AK1, MGC126524, PKR, PRKR
Protein Size (# AA) 551 amino acids
Molecular Weight 62kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 5610
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Eukaryotic translation initiation factor 2-alpha kinase 2
Description This is a rabbit polyclonal antibody against EIF2AK2. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: IISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC
Target Reference Alisi,A., et al., (2005) J Cell Physiol. 205(1), 25-31
Description of Target EIF2AK2 might play a role in ER stress-induced apoptosis and in Alzheimer's disease. Alzheimer cases show prominent EIF2AK2 activation in association with neuritic plaques and pyramidal neurons in the hippocampus and neocortex.
Protein Interactions UBC; TRAF6; TRAF5; TRAF2; EGFR; DHX9; STAU2; PRKRA; EIF2AK2; HECW2; TOP1; STAU1; DICER1; DHX30; EBNA1BP2; IGF2BP2; IGF2BP3; PABPC4; MOV10; ILF3; ILF2; HSP90AA1; EIF2A; NOC3L; GNL3; NOP2; HNRNPC; HIST1H1C; ELAVL1; NPM1; IL7R; gag; Jak2; TYK2; JAK1; EIF2S1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-EIF2AK2 (AVARP09033_P050) antibody is Catalog # AAP30599 (Previous Catalog # AAPP01252)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EIF2AK2
Complete computational species homology data Anti-EIF2AK2 (AVARP09033_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EIF2AK2.
Swissprot Id P19525
Protein Name Interferon-induced, double-stranded RNA-activated protein kinase
Protein Accession # NP_002750
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EIF2AK2.
Nucleotide Accession # NM_002759
Replacement Item This antibody may replace item sc-100378 from Santa Cruz Biotechnology.
Conjugation Options

AVARP09033_P050-FITC Conjugated

AVARP09033_P050-HRP Conjugated

AVARP09033_P050-Biotin Conjugated

CB Replacement sc-100378; sc-122612; sc-136038; sc-136352; sc-1702; sc-36263; sc-36264; sc-366777; sc-366778; sc-393038; sc-514626; sc-6282; sc-707; sc-708; sc-709
Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Stomach
WB Suggested Anti-EIF2AK2 Antibody Titration: 0.125ug/ml
Positive Control: Human Stomach
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com