RGS9 Antibody - N-terminal region (AVARP09024_T100)

Data Sheet
 
Product Number AVARP09024_T100
Product Page www.avivasysbio.com/rgs9-antibody-n-terminal-region-avarp09024-t100.html
Name RGS9 Antibody - N-terminal region (AVARP09024_T100)
Protein Size (# AA) 443 amino acids
Molecular Weight 49kDa
NCBI Gene Id 8787
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Regulator of G-protein signaling 9
Alias Symbols PERRS, RGS9L
Peptide Sequence Synthetic peptide located within the following region: MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ajit,S.K., et al., (2004) Biochem. Biophys. Res. Commun. 324(2),686-691
Description of Target RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.
Protein Interactions ADRB2; Dlg4; UBC; RGS7BP; RGS9BP; GNB5; GNAO1; GNAT1; GUCY2D;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RGS9 (AVARP09024_T100) antibody
Blocking Peptide For anti-RGS9 (AVARP09024_T100) antibody is Catalog # AAP30356 (Previous Catalog # AAPP00814)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RGS9
Uniprot ID O75916
Protein Name Regulator of G-protein signaling 9
Protein Accession # NP_003826
Purification Protein A purified
Nucleotide Accession # NM_003835
Tested Species Reactivity Human
Gene Symbol RGS9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-RGS9 Antibody Titration: 2.0ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Liver
Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com