Product Number |
AVARP09012_T100 |
Product Page |
www.avivasysbio.com/dnajb5-antibody-n-terminal-region-avarp09012-t100.html |
Name |
DNAJB5 Antibody - N-terminal region (AVARP09012_T100) |
Protein Size (# AA) |
348 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
25822 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
DnaJ (Hsp40) homolog, subfamily B, member 5 |
Alias Symbols |
Hsc40 |
Peptide Sequence |
Synthetic peptide located within the following region: MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chen, M.S., et al., (1999) Gene 238:333-341. |
Description of Target |
HSP40 is a new member of the hsp40 family, exhibits similar expression profile to that of hsc70 in mammalian cells. |
Protein Interactions |
ASB4; UBC; SKP2; EBNA-LP; CACNA1A; TBPL2; HDAC4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DNAJB5 (AVARP09012_T100) antibody |
Blocking Peptide |
For anti-DNAJB5 (AVARP09012_T100) antibody is Catalog # AAP30178 (Previous Catalog # AAPP00335) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB5 |
Uniprot ID |
O75953 |
Protein Name |
DnaJ homolog subfamily B member 5 |
Protein Accession # |
NP_036398 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_012266 |
Gene Symbol |
DNAJB5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | |
|