CMKLR1 Antibody - C-terminal region (AVARP07056_P050)

• Product Number: AVARP07056_P050
• Name: CMKLR1 Antibody - C-terminal region (AVARP07056_P050)
• Protein Size (# AA): 371 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 1240
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chemokine-like receptor 1
• Alias Symbols: DEZ, RVER1, ChemR23, CHEMERINR
• Peptide Sequence: Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Samson,M., et al., (1998) Eur. J. Immunol. 28 (5), 1689-1700
• Description of Target: CMKLR1 mediates the Resolvin E1 signal to attenuate nuclear factor-kappaB.
• Protein Interactions: TPST2; TPST1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CMKLR1 (AVARP07056_P050) antibody is Catalog # AAP30866 (Previous Catalog # AAPP33507)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CMKLR1
• Uniprot ID: Q5U0H0
• Protein Name: Chemokine-like receptor 1
• Protein Accession #: NP_004063
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004072
• Tested Species Reactivity: Human
• Gene Symbol: CMKLR1
• Predicted Species Reactivity: Human, Mouse, Rat
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 93%; Rat: 93%
• Image 1: Human HepG2
  
  WB Suggested Anti-CMKLR1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human Liver Tumor, Human Lung Tumor
  
  Host: Rabbit
  Target: CMKLR1
  Positive control (+): Human Liver Tumor (T-LI)
  Negative control (-): Human Lung Tumor (T-LU)
  Antibody concentration: 3ug/ml