CCL18 Antibody - middle region (AVARP07049_P050)

• Product Number: AVARP07049_P050
• Name: CCL18 Antibody - middle region (AVARP07049_P050)
• Protein Size (# AA): 89 amino acids
• Molecular Weight: 10kDa
• NCBI Gene Id: 6362
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
• Alias Symbols: CKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, SCYA18
• Peptide Sequence: Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Schraufstatter,I., et al., (2004) Am. J. Physiol. Lung Cell Mol. Physiol. 286 (3), L494-L501
• Description of Target: CCL18 is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by CCL18 displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses.
• Protein Interactions: C14orf1; UNC119; CRMP1; TLE1; TP53; EEF1A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CCL18 (AVARP07049_P050) antibody is Catalog # AAP30861 (Previous Catalog # AAPP01530)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCL18
• Uniprot ID: P55774
• Protein Name: C-C motif chemokine 18
• Protein Accession #: NP_002979
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002988
• Tested Species Reactivity: Human
• Gene Symbol: CCL18
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: CCL18
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Human lung, HepG2
  
  Host: Rabbit
  Target: CCL18
  Positive control (+): Human lung (LU)
  Negative control (-): HepG2 (HG)
  Antibody concentration: 1ug/ml
• Image 3: Human Intestine
  
  Human Intestine
• Image 4: Human Fetal Lung
  
  Host: Rabbit
  Target Name: CCL18
  Sample Type: Fetal Lung lysates
  Antibody Dilution: 0.5ug/ml