Product Number |
AVARP07037_T100 |
Product Page |
www.avivasysbio.com/cxcl3-antibody-middle-region-avarp07037-t100.html |
Name |
CXCL3 Antibody - middle region (AVARP07037_T100) |
Protein Size (# AA) |
107 amino acids |
Molecular Weight |
11kDa |
NCBI Gene Id |
2921 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chemokine (C-X-C motif) ligand 3 |
Alias Symbols |
GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b |
Peptide Sequence |
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tekamp-Olson, P., et al., (1990) J. Exp. Med. 172:911-919. |
Description of Target |
CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. |
Protein Interactions |
CXCR1; CXCR2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-CXCL3 (AVARP07037_T100) antibody |
Blocking Peptide |
For anti-CXCL3 (AVARP07037_T100) antibody is Catalog # AAP30824 (Previous Catalog # AAPP01488) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CXCL3 |
Uniprot ID |
P19876 |
Protein Name |
C-X-C motif chemokine 3 |
Publications |
Cheng, C.-F. et al. Profiling motility signal-specific genes in primary human keratinocytes. J. Invest. Dermatol. 128, 1981-90 (2008). 18323786 |
Protein Accession # |
NP_002081 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_002090 |
Gene Symbol |
CXCL3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Western Blot
| 25 ug of the indicated whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
|