CXCL3 Antibody - middle region (AVARP07037_T100)

Data Sheet
 
Product Number AVARP07037_T100
Product Page www.avivasysbio.com/cxcl3-antibody-middle-region-avarp07037-t100.html
Name CXCL3 Antibody - middle region (AVARP07037_T100)
Protein Size (# AA) 107 amino acids
Molecular Weight 11kDa
NCBI Gene Id 2921
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chemokine (C-X-C motif) ligand 3
Alias Symbols GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b
Peptide Sequence Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tekamp-Olson, P., et al., (1990) J. Exp. Med. 172:911-919.
Description of Target CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Protein Interactions CXCR1; CXCR2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-CXCL3 (AVARP07037_T100) antibody
Blocking Peptide For anti-CXCL3 (AVARP07037_T100) antibody is Catalog # AAP30824 (Previous Catalog # AAPP01488)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL3
Uniprot ID P19876
Protein Name C-X-C motif chemokine 3
Publications

Cheng, C.-F. et al. Profiling motility signal-specific genes in primary human keratinocytes. J. Invest. Dermatol. 128, 1981-90 (2008). 18323786

Protein Accession # NP_002081
Purification Protein A purified
Nucleotide Accession # NM_002090
Gene Symbol CXCL3
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Western Blot
25 ug of the indicated whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com