| Product Number |
AVARP07023_T100 |
| Product Page |
www.avivasysbio.com/cxcl14-antibody-middle-region-avarp07023-t100.html |
| Name |
CXCL14 Antibody - middle region (AVARP07023_T100) |
| Protein Size (# AA) |
111 amino acids |
| Molecular Weight |
13kDa |
| NCBI Gene Id |
9547 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Chemokine (C-X-C motif) ligand 14 |
| Alias Symbols |
KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14 |
| Peptide Sequence |
Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270 |
| Description of Target |
CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. |
| Protein Interactions |
TEX11; TRIM23; REL; APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CXCL14 (AVARP07023_T100) antibody |
| Blocking Peptide |
For anti-CXCL14 (AVARP07023_T100) antibody is Catalog # AAP30802 (Previous Catalog # AAPP01465) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CXCL14 |
| Uniprot ID |
Q9NS21 |
| Protein Name |
C-X-C motif chemokine 14 |
| Protein Accession # |
NP_004878 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004887 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CXCL14 |
| Predicted Species Reactivity |
Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-CXCL14 Antibody Titration: 5.0ug/ml
Positive Control: Human muscle |
|
|
