Product Number |
AVARP07007_P050 |
Product Page |
www.avivasysbio.com/ccl13-antibody-middle-region-avarp07007-p050.html |
Name |
CCL13 Antibody - middle region (AVARP07007_P050) |
Protein Size (# AA) |
98 amino acids |
Molecular Weight |
11kDa |
NCBI Gene Id |
6357 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chemokine (C-C motif) ligand 13 |
Alias Symbols |
NCC1, CKb10, MCP-4, NCC-1, SCYL1, SCYA13 |
Peptide Sequence |
Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kalayci,O., (2003) Am. J. Respir. Cell Mol. Biol. 29 (6), 750-756 |
Description of Target |
Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL13 displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. |
Protein Interactions |
APP; ACKR2; ACKR4; HNRNPH3; CCR5; CCR3; CCR2; MMP3; MMP1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CCL13 (AVARP07007_P050) antibody |
Blocking Peptide |
For anti-CCL13 (AVARP07007_P050) antibody is Catalog # AAP30797 (Previous Catalog # AAPP01460) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCL13 |
Uniprot ID |
Q99616 |
Protein Name |
C-C motif chemokine 13 |
Sample Type Confirmation |
CCL13 is supported by BioGPS gene expression data to be expressed in HEK293T |
Protein Accession # |
NP_005399 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005408 |
Tested Species Reactivity |
Human |
Gene Symbol |
CCL13 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human 293T
| WB Suggested Anti-CCL13 Antibody Titration: 0.2-1 ug/ml Positive Control: Transfected 293TCCL13 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
|