CCL13 Antibody - middle region (AVARP07007_P050)

Data Sheet
 
Product Number AVARP07007_P050
Product Page www.avivasysbio.com/ccl13-antibody-middle-region-avarp07007-p050.html
Name CCL13 Antibody - middle region (AVARP07007_P050)
Protein Size (# AA) 98 amino acids
Molecular Weight 11kDa
NCBI Gene Id 6357
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chemokine (C-C motif) ligand 13
Alias Symbols NCC1, CKb10, MCP-4, NCC-1, SCYL1, SCYA13
Peptide Sequence Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kalayci,O., (2003) Am. J. Respir. Cell Mol. Biol. 29 (6), 750-756
Description of Target Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL13 displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.
Protein Interactions APP; ACKR2; ACKR4; HNRNPH3; CCR5; CCR3; CCR2; MMP3; MMP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCL13 (AVARP07007_P050) antibody
Blocking Peptide For anti-CCL13 (AVARP07007_P050) antibody is Catalog # AAP30797 (Previous Catalog # AAPP01460)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCL13
Uniprot ID Q99616
Protein Name C-C motif chemokine 13
Sample Type Confirmation

CCL13 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_005399
Purification Affinity Purified
Nucleotide Accession # NM_005408
Tested Species Reactivity Human
Gene Symbol CCL13
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human 293T
WB Suggested Anti-CCL13 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293TCCL13 is supported by BioGPS gene expression data to be expressed in HEK293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com