CDKN2B Antibody - middle region (AVARP03047_P050)

Data Sheet
 
Product Number AVARP03047_P050
Product Page www.avivasysbio.com/cdkn2b-antibody-middle-region-avarp03047-p050.html
Name CDKN2B Antibody - middle region (AVARP03047_P050)
Protein Size (# AA) 138 amino acids
Molecular Weight 15kDa
NCBI Gene Id 1030
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Alias Symbols P15, MTS2, TP15, CDK4I, INK4B, p15INK4b
Peptide Sequence Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Scott,S.A., et al., (2004) Leuk. Res. 28 (12), 1293-1301
Description of Target CDKN2B's gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. CDKN2B is a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition.
Protein Interactions UBC; TRAF1; CDK6; CCDC33; NIF3L1; CDK4; PYCRL; RNF20; TGFB1I1; ISL1; APP; KIAA1377; CCDC90B; ARPC3; ZBTB17; IKBKAP; CDK8; MAGEA11; PIAS2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDKN2B (AVARP03047_P050) antibody
Blocking Peptide For anti-CDKN2B (AVARP03047_P050) antibody is Catalog # AAP30194 (Previous Catalog # AAPP00351)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDKN2B
Uniprot ID P42772
Protein Name Cyclin-dependent kinase 4 inhibitor B
Protein Accession # NP_004927
Nucleotide Accession # NM_004936
Tested Species Reactivity Human
Gene Symbol CDKN2B
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 91%; Guinea Pig: 83%; Mouse: 83%; Pig: 100%; Rabbit: 91%; Rat: 83%
Image 1
Human Lung Tumor
Host: Rabbit
Target Name: CDKN2B
Sample Tissue: Human Lung Tumor
Antibody Dilution: 1ug/ml
Image 2
Human Jurkat
WB Suggested Anti-CDKN2B Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com