CCNA2 Antibody - C-terminal region (AVARP03045_T100)

Data Sheet
 
Product Number AVARP03045_T100
Product Page www.avivasysbio.com/ccna2-antibody-c-terminal-region-avarp03045-t100.html
Name CCNA2 Antibody - C-terminal region (AVARP03045_T100)
Protein Size (# AA) 432 amino acids
Molecular Weight 49kDa
NCBI Gene Id 890
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cyclin A2
Alias Symbols CCN1, CCNA
Peptide Sequence Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wang, J., et al., (1990) Nature 343: 555-557.
Description of Target Cyclin A is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.
Protein Interactions UBC; CDC20; Samhd1; BIRC6; ANAPC11; CDKN1A; CDK4; CDK2; CDK1; DYRK1A; DYRK1B; CDK3; CDKN1B; CDK5; TP73; RB1; POLA1; CTNNB1; NFYB; NFYA; CDK7; HIST1H1A; HIST1H1B; CDC6; BRCA2; TRIM33; RBL2; PRC1; Mdm2; CDT1; FZR1; CCNA2; SKP2; RAD23A; PSMD4; USP37; COPS5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCNA2 (AVARP03045_T100) antibody
Blocking Peptide For anti-CCNA2 (AVARP03045_T100) antibody is Catalog # AAP30348 (Previous Catalog # AAPP00806)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CCNA2
Uniprot ID P20248
Protein Name Cyclin-A2
Sample Type Confirmation

CCNA2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001228
Purification Protein A purified
Nucleotide Accession # NM_001237
Tested Species Reactivity Human
Gene Symbol CCNA2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 91%; Zebrafish: 81%
Image 1
Human HepG2
WB Suggested Anti-CCNA2 Antibody Titration: 1ug/ml
Positive Control: HepG2 cell lysateCCNA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com