CDK7 Antibody - C-terminal region (AVARP03009_T100)

Data Sheet
 
Product Number AVARP03009_T100
Product Page www.avivasysbio.com/cdk7-antibody-c-terminal-region-avarp03009-t100.html
Name CDK7 Antibody - C-terminal region (AVARP03009_T100)
Protein Size (# AA) 346 amino acids
Molecular Weight 39kDa
NCBI Gene Id 1022
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cyclin-dependent kinase 7
Alias Symbols CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15
Peptide Sequence Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tassan, J.P., et al., (1994) J. Cell Biol. 127:467-478.
Description of Target Cdk7 is the catalytic subunit of the CDK-activating kinase (CAK) complex, a serine-threonine kinase. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcripti
Protein Interactions UBC; RPA3; RPA2; RPA1; GTF2H4; GTF2H3; GTF2H2; GTF2H1; ERCC5; ERCC3; ERCC2; CDK7; CCNH; ATP2B4; A2M; GTF2H5; SRPK2; SRPK1; MNAT1; TP53; CDK2; CTD; MBP; CDK1; CCNB1; CCNA2; Dlg4; UVSSA; HSP90AA1; HSD17B4; HLA-DQA1; SUPT5H; POLR2A; GTF2E2; GTF2E1; CDK9; APP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDK7 (AVARP03009_T100) antibody
Blocking Peptide For anti-CDK7 (AVARP03009_T100) antibody is Catalog # AAP30134 (Previous Catalog # AAPP00205)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CDK7
Uniprot ID P50613
Protein Name Cyclin-dependent kinase 7
Protein Accession # NP_001790
Purification Protein A purified
Nucleotide Accession # NM_001799
Tested Species Reactivity Human
Gene Symbol CDK7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application IHC, WB, IP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 94%; Guinea Pig: 94%; Horse: 100%; Human: 100%; Mouse: 88%; Pig: 100%; Rat: 88%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-CDK7 Antibody Titration: 1ug/ml
Positive Control: Jurkat cell lysate
Image 3
Human Intestine
Human Intestine
Image 4
HEK293 Whole Cell Lysate
CDK7 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with AVARP03009_T100 with 1:200 dilution. Western blot was performed using AVARP03009_T100 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: CDK7 IP with AVARP03009_T100 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com