SEPT4 Antibody - N-terminal region (AVARP02014_P050)

Data Sheet
 
Product Number AVARP02014_P050
Product Page www.avivasysbio.com/sept4-antibody-n-terminal-region-avarp02014-p050.html
Name SEPT4 Antibody - N-terminal region (AVARP02014_P050)
Protein Size (# AA) 478 amino acids
Molecular Weight 55kDa
NCBI Gene Id 5414
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Septin 4
Alias Symbols H5, ARTS, MART, SEP4, CE5B3, SEPT4, PNUTL2, hucep-7, BRADEION, C17orf47, hCDCREL-2
Peptide Sequence Synthetic peptide located within the following region: RSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Elhasid,R., et al., (2004) Oncogene 23 (32), 5468-5475
Description of Target The SEPT4 gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. SEPT4 encodes a protein that is thought to be part of a complex involved in cytokinesis.
Protein Interactions XIAP; AREL1; UBC; Caskin1; SNCA; BIRC3; SIAH1; SEPT8; SNCAIP; SEPT4; SEPT5; SNCB; PARK2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SEPT4 (septin-4) (AVARP02014_P050) antibody
Blocking Peptide For anti-SEPT4 (septin-4) (AVARP02014_P050) antibody is Catalog # AAP30429 (Previous Catalog # AAPP01012)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT4 (septin-4)
Uniprot ID O43236
Protein Name Septin-4
Protein Accession # NP_004565
Purification Affinity Purified
Nucleotide Accession # NM_004574
Tested Species Reactivity Human
Gene Symbol SEPT4
Predicted Species Reactivity Human, Dog
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 84%; Human: 100%
Image 1
Human Heart
Human Heart
Image 2
Human cerebellum
WB Suggested Anti-SEPT4 Titration: 0.2-1 ug/ml
Positive Control: Human cerebellum
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com