Product Number |
ARP64734_P050 |
Product Page |
www.avivasysbio.com/ido2-antibody-c-terminal-region-arp64734-p050.html |
Name |
IDO2 Antibody - C-terminal region (ARP64734_P050) |
Protein Size (# AA) |
420 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
169355 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
INDOL1 |
Peptide Sequence |
Synthetic peptide located within the following region: LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Along with the enzymes encoded by the INDO and TDO2 genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-IDO2 (ARP64734_P050) antibody |
Blocking Peptide |
For anti-IDO2 (ARP64734_P050) antibody is Catalog # AAP64734 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IDO2 |
Uniprot ID |
F5H5G0 |
Protein Name |
Indoleamine 2,3-dioxygenase 2 Ensembl ENSP00000443432 |
Protein Accession # |
NP_919270 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_194294 |
Tested Species Reactivity |
Human |
Gene Symbol |
IDO2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 83%; Pig: 91%; Rabbit: 79%; Rat: 79% |
Image 1 | Human Fetal Brain
| WB Suggested Anti-IDO2 Antibody Titration: 1.0 ug/ml Positive Control: Fetal Brain |
|
|