IDO2 Antibody - C-terminal region (ARP64734_P050)

Data Sheet
 
Product Number ARP64734_P050
Product Page www.avivasysbio.com/ido2-antibody-c-terminal-region-arp64734-p050.html
Name IDO2 Antibody - C-terminal region (ARP64734_P050)
Protein Size (# AA) 420 amino acids
Molecular Weight 47kDa
NCBI Gene Id 169355
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols INDOL1
Peptide Sequence Synthetic peptide located within the following region: LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Along with the enzymes encoded by the INDO and TDO2 genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IDO2 (ARP64734_P050) antibody
Blocking Peptide For anti-IDO2 (ARP64734_P050) antibody is Catalog # AAP64734
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human IDO2
Uniprot ID F5H5G0
Protein Name Indoleamine 2,3-dioxygenase 2 Ensembl ENSP00000443432
Protein Accession # NP_919270
Purification Affinity Purified
Nucleotide Accession # NM_194294
Tested Species Reactivity Human
Gene Symbol IDO2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 83%; Pig: 91%; Rabbit: 79%; Rat: 79%
Image 1
Human Fetal Brain
WB Suggested Anti-IDO2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com