CD151 Antibody - C-terminal region (ARP63500_P050)

• Product Number: ARP63500_P050
• Name: CD151 Antibody - C-terminal region (ARP63500_P050)
• Protein Size (# AA): 253 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 977
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CD151 molecule (Raph blood group)
• Alias Symbols: GP27, MER2, RAPH, SFA1, PETA-3, TSPAN24
• Peptide Sequence: Synthetic peptide located within the following region: HCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.
• Protein Interactions: GRAMD1C; UBC; ITGA3; PTGFRN; MMP7; ITGA6; ITGB1; CD46; CD82;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CD151 (ARP63500_P050) antibody is Catalog # AAP63500
• Uniprot ID: P48509
• Protein Name: CD151 antigen
• Sample Type Confirmation:

  CD151 is supported by BioGPS gene expression data to be expressed in A549

• Protein Accession #: NP_620599
• Purification: Affinity Purified
• Nucleotide Accession #: NM_139030
• Tested Species Reactivity: Human
• Gene Symbol: CD151
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
• Image 1: Human nasal epithelial
  
  Application: IHC
  Species+tissue/cell type:Human nasal epithelial cells
  Primary antibody dilution: 1:1000
  Secondary antibody: Goat anti-rabbit Alexa Fluor 546
  Secondary antibody dilution:1:1000
• Image 2: Human A549
  
  WB Suggested Anti-CD151 Antibody
  Titration: 1.0 ug/ml
  Positive Control: A549 Whole CellCD151 is supported by BioGPS gene expression data to be expressed in A549
• Image 3:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.