| Product Number |
ARP62688_P050 |
| Product Page |
www.avivasysbio.com/mrpl3-antibody-n-terminal-region-arp62688-p050.html |
| Name |
MRPL3 Antibody - N-terminal region (ARP62688_P050) |
| Protein Size (# AA) |
348 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
11222 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Mitochondrial ribosomal protein L3 |
| Alias Symbols |
MRL3, RPML3, COXPD9 |
| Peptide Sequence |
Synthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q. |
| Protein Interactions |
UBC; MRPS27; mug82; ICT1; C1QBP; MRPL55; MRPL10; MRPL52; MRPL9; MRPL41; MRPS9; MRPL17; MRPL39; MRPL4; MRPL13; MRPL42; MRPL46; MRPL19; RPS18; RPS15; MRPL12; MRPL23; NDUFS3; APP; CAND1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MRPL3 (ARP62688_P050) antibody |
| Blocking Peptide |
For anti-MRPL3 (ARP62688_P050) antibody is Catalog # AAP62688 |
| Uniprot ID |
P09001 |
| Protein Name |
39S ribosomal protein L3, mitochondrial |
| Protein Accession # |
NP_009139 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007208 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MRPL3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Placenta
 | WB Suggested Anti-MRPL3 Antibody
Titration: 1.0 ug/ml
Positive Control: Placenta |
|
|
