PUS1 Antibody - N-terminal region (ARP61749_P050)

Data Sheet
 
Product Number ARP61749_P050
Product Page www.avivasysbio.com/pus1-antibody-n-terminal-region-arp61749-p050.html
Name PUS1 Antibody - N-terminal region (ARP61749_P050)
Protein Size (# AA) 423 amino acids
Molecular Weight 48kDa
NCBI Gene Id 80324
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Pseudouridylate synthase 1
Alias Symbols MLASA1
Peptide Sequence Synthetic peptide located within the following region: LVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Pus1 converts specific uridines to PSI in a number of tRNA substrates. Pus1 acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA. Pus1 is involved in regulation of nuclear receptor activi
Protein Interactions UBC; VPS25; P3H1; NSUN2; VPS29; ARPC2; ACTR3; SP100; RPA1; PFDN5; PFDN1; NRD1; NCBP1; NARS; PPP1R12A; IDE; GTF2F1; FARSA; BCAT1; AGL; ECT2; PSMD11; SUMO2; ICT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PUS1 (ARP61749_P050) antibody
Blocking Peptide For anti-PUS1 (ARP61749_P050) antibody is Catalog # AAP61749 (Previous Catalog # AAPP48231)
Uniprot ID Q791J1
Protein Name tRNA pseudouridine synthase RuleBase RU003792
Sample Type Confirmation

PUS1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001002019
Purification Affinity Purified
Nucleotide Accession # NM_001002019
Tested Species Reactivity Human
Gene Symbol PUS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-PUS1 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole CellPUS1 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com