| Product Number |
ARP61611_P050 |
| Product Page |
www.avivasysbio.com/nxn-antibody-n-terminal-region-arp61611-p050.html |
| Name |
NXN Antibody - N-terminal region (ARP61611_P050) |
| Protein Size (# AA) |
327 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
64359 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nucleoredoxin |
| Alias Symbols |
NRX, RRS2, TRG-4 |
| Peptide Sequence |
Synthetic peptide located within the following region: VYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
UBC; ELAVL1; USP3; PPP2CA; CHMP6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NXN (ARP61611_P050) antibody |
| Blocking Peptide |
For anti-NXN (ARP61611_P050) antibody is Catalog # AAP61611 (Previous Catalog # AAPP47714) |
| Uniprot ID |
B4DXQ0 |
| Protein Name |
Nucleoredoxin |
| Sample Type Confirmation |
NXN is supported by BioGPS gene expression data to be expressed in NCIH226 |
| Protein Accession # |
NP_001192248 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001205319 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NXN |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human NCI-H226
 | WB Suggested Anti-NXN Antibody
Titration: 1.0 ug/ml
Positive Control: NCI-H226 Whole CellNXN is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
|
