RFC2 Antibody - middle region (ARP61587_P050)

Data Sheet
 
Product Number ARP61587_P050
Product Page www.avivasysbio.com/rfc2-antibody-middle-region-arp61587-p050.html
Name RFC2 Antibody - middle region (ARP61587_P050)
Protein Size (# AA) 320 amino acids
Molecular Weight 35kDa
Subunit 2
NCBI Gene Id 5982
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Replication factor C (activator 1) 2, 40kDa
Alias Symbols RFC40
Peptide Sequence Synthetic peptide located within the following region: IQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also called activator 1, is a protein complex consisting of five distinct subunits of 145, 40, 38, 37, and 36.5 kD. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP. Deletion of this gene has been associated with Williams syndrome.
Protein Interactions CEP76; SUMO2; PCNA; UBC; RPA3; RPA2; RPA1; C14orf166; RTCB; LRRFIP1; PRKDC; KRT18; FLII; DDX1; RFC4; PRKAR1A; PAXIP1; MDC1; TP53BP1; ECT2; BRCA1; BARD1; CHTF18; RFC5; RFC3; RFC1; PURA; NEDD8; RAD18; CAND1; COPS5; CUL3; SMARCAD1; MYC; tat; DDX11; CHD1L; PM
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RFC2 (ARP61587_P050) antibody
Blocking Peptide For anti-RFC2 (ARP61587_P050) antibody is Catalog # AAP61587 (Previous Catalog # AAPP47694)
Uniprot ID Q75MT5
Protein Name Putative uncharacterized protein RFC2 EMBL AAP22335.1
Sample Type Confirmation

RFC2 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

Protein Accession # NP_002905
Purification Affinity Purified
Nucleotide Accession # NM_002914
Tested Species Reactivity Human
Gene Symbol RFC2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human OVCAR3
WB Suggested Anti-RFC2 Antibody
Titration: 1.0 ug/ml
Positive Control: OVCAR-3 Whole CellRFC2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com