NUP153 Antibody - C-terminal region (ARP61446_P050)

Data Sheet
 
Product Number ARP61446_P050
Product Page www.avivasysbio.com/nup153-antibody-c-terminal-region-arp61446-p050.html
Name NUP153 Antibody - C-terminal region (ARP61446_P050)
Protein Size (# AA) 1475 amino acids
Molecular Weight 162kDa
NCBI Gene Id 9972
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nucleoporin 153kDa
Alias Symbols N153, HNUP153
Peptide Sequence Synthetic peptide located within the following region: PKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Nuclear pore complexes are extremely elaborate structures that mediate the regulated movement of macromolecules between the nucleus and cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are pore complex-specific glycoproteins characterized by cytoplasmically oriented O-linked N-acetylglucosamine residues and numerous repeats of the pentapeptide sequence XFXFG. The protein encoded by this gene has three distinct domains: a N-terminal region within which a pore targeting domain has been identified, a central region containing multiple zinc finger motifs, and a C-terminal region containing multiple XFXFG repeats.
Protein Interactions UBC; HDAC11; LMNA; ESR1; PNPT1; DPY30; FIP1L1; NUP107; NUP54; NUP50; NCAPD2; PRKCSH; MEA1; EIF4B; EEF1B2; CSTF2; C1QBP; CUL3; SIRT7; RANBP2; CTNNB1; XPO7; SUMO2; SMAD3; SUMO1; MAPK3; MAPK1; Mki67; Kifc5b; MYC; KPNB1; tat; APC; USP20; USP11; TPR; SENP2; XP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUP153 (ARP61446_P050) antibody
Blocking Peptide For anti-NUP153 (ARP61446_P050) antibody is Catalog # AAP61446 (Previous Catalog # AAPP47555)
Uniprot ID P49790
Protein Name Nuclear pore complex protein Nup153
Protein Accession # NP_005115
Purification Affinity Purified
Nucleotide Accession # NM_005124
Tested Species Reactivity Human
Gene Symbol NUP153
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 93%; Rat: 92%
Image 1
Human Fetal Lung
WB Suggested Anti-NUP153 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com