| Product Number |
ARP61376_P050 |
| Product Page |
www.avivasysbio.com/cd244-antibody-c-terminal-region-arp61376-p050.html |
| Name |
CD244 Antibody - C-terminal region (ARP61376_P050) |
| Protein Size (# AA) |
365 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
51744 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CD244 molecule, natural killer cell receptor 2B4 |
| Alias Symbols |
2B4, NAIL, Nmrk, NKR2B4, SLAMF4 |
| Peptide Sequence |
Synthetic peptide located within the following region: FRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
SH2D1A; FYN; SH2D1B; ARHGEF7; LAT; CD247; CD48; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CD244 (ARP61376_P050) antibody |
| Blocking Peptide |
For anti-CD244 (ARP61376_P050) antibody is Catalog # AAP61376 (Previous Catalog # AAPP47491) |
| Uniprot ID |
B2R820 |
| Protein Name |
cDNA, FLJ93700, highly similar to Homo sapiens CD244 natural killer cell receptor 2B4 (CD244), mRNA EMBL BAG36017.1 |
| Sample Type Confirmation |
CD244 is supported by BioGPS gene expression data to be expressed in COLO205 |
| Protein Accession # |
NP_057466 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016382 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CD244 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human COLO205
 | WB Suggested Anti-CD244 Antibody
Titration: 1.0 ug/ml
Positive Control: COLO205 Whole CellCD244 is supported by BioGPS gene expression data to be expressed in COLO205 |
|
|
