| Product Number |
ARP61228_P050 |
| Product Page |
www.avivasysbio.com/ogg1-antibody-c-terminal-region-arp61228-p050.html |
| Name |
OGG1 Antibody - C-terminal region (ARP61228_P050) |
| Protein Size (# AA) |
345 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
4968 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
8-oxoguanine DNA glycosylase |
| Alias Symbols |
HMMH, MUTM, OGH1, HOGG1 |
| Peptide Sequence |
Synthetic peptide located within the following region: AVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. |
| Protein Interactions |
ERCC6; ERCC8; UBC; Ogg1; CHGB; XRCC1; PRKCA; SNRPF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-OGG1 (ARP61228_P050) antibody |
| Specificity |
Directed against isoforms 2D, 1A, 1B, 2E. |
| Blocking Peptide |
For anti-OGG1 (ARP61228_P050) antibody is Catalog # AAP61228 (Previous Catalog # AAPP47373) |
| Uniprot ID |
O15527 |
| Protein Name |
N-glycosylase/DNA lyase |
| Protein Accession # |
NP_058438 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016829 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
OGG1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 92%; Rat: 79% |
| Image 1 | Human ACHN
 | WB Suggested Anti-OGG1 Antibody
Titration: 1.0 ug/ml
Positive Control: ACHN Whole Cell |
|
|
