| Product Number |
ARP61204_P050 |
| Product Page |
www.avivasysbio.com/duoxa1-antibody-c-terminal-region-arp61204-p050.html |
| Name |
DUOXA1 Antibody - C-terminal region (ARP61204_P050) |
| Protein Size (# AA) |
483 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
90527 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Dual oxidase maturation factor 1 |
| Alias Symbols |
NIP, mol, NUMBIP |
| Peptide Sequence |
Synthetic peptide located within the following region: PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
LYN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DUOXA1 (ARP61204_P050) antibody |
| Blocking Peptide |
For anti-DUOXA1 (ARP61204_P050) antibody is Catalog # AAP61204 (Previous Catalog # AAPP47356) |
| Uniprot ID |
A8K9Q6 |
| Protein Name |
Dual oxidase maturation factor 1 gamma EMBL ACH57455.1 |
| Protein Accession # |
NP_653166 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_144565 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DUOXA1 |
| Predicted Species Reactivity |
Human, Cow, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 79%; Human: 100%; Pig: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-DUOXA1 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell |
|
|
