PRTN3 Antibody - N-terminal region (ARP61166_P050)

Data Sheet
 
Product Number ARP61166_P050
Product Page www.avivasysbio.com/prtn3-antibody-n-terminal-region-arp61166-p050.html
Name PRTN3 Antibody - N-terminal region (ARP61166_P050)
Protein Size (# AA) 256 amino acids
Molecular Weight 28kDa
NCBI Gene Id 5657
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Proteinase 3
Alias Symbols MBN, MBT, NP4, P29, PR3, ACPA, AGP7, NP-4, PR-3, CANCA, C-ANCA
Peptide Sequence Synthetic peptide located within the following region: IPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target PRTN3 is a polymorphonuclear leukocyte serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) and causes emphysema when administered by tracheal insufflation to hamsters.
Protein Interactions Serpinb1a; SMAD3; IL32; SERPINB13; F2RL1; CAMP; ITGB2; SERPINA1; TNF; F2R; RELA; IL1B; ELN; SERPINB1; ITGAM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRTN3 (ARP61166_P050) antibody
Blocking Peptide For anti-PRTN3 (ARP61166_P050) antibody is Catalog # AAP61166 (Previous Catalog # AAPP47317)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRTN3
Uniprot ID P24158
Protein Name Myeloblastin
Protein Accession # NP_002768
Purification Affinity Purified
Nucleotide Accession # NM_002777
Tested Species Reactivity Human
Gene Symbol PRTN3
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Fetal Lung
WB Suggested Anti-PRTN3 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com