GC Antibody - N-terminal region (ARP61150_P050)

Data Sheet
 
Product Number ARP61150_P050
Product Page www.avivasysbio.com/gc-antibody-n-terminal-region-arp61150-p050.html
Name GC Antibody - N-terminal region (ARP61150_P050)
Protein Size (# AA) 493 amino acids
Molecular Weight 54kDa
NCBI Gene Id 2638
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Group-specific component (vitamin D binding protein)
Alias Symbols DBP, VDB, GRD3, VDBG, VDBP, GcMAF, DBP/GC, Gc-MAF, DBP-maf, HEL-S-51
Peptide Sequence Synthetic peptide located within the following region: KFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Interactions CCND3; PIK3R3; GRB2; LRIF1; CDC73; SERF2; CUBN; LRP2; GC; C3; ACTA2; ACTA1; ACTC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GC (ARP61150_P050) antibody
Blocking Peptide For anti-GC (ARP61150_P050) antibody is Catalog # AAP61150 (Previous Catalog # AAPP48201)
Uniprot ID D6RAK8
Protein Name Vitamin D-binding protein
Protein Accession # NP_001191236
Purification Affinity Purified
Nucleotide Accession # NM_001204307
Tested Species Reactivity Human
Gene Symbol GC
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 79%; Rat: 93%
Image 1
Human 721_B
WB Suggested Anti-GC Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com