ACSS2 Antibody - N-terminal region (ARP61137_P050)

Data Sheet
 
Product Number ARP61137_P050
Product Page www.avivasysbio.com/acss2-antibody-n-terminal-region-arp61137-p050.html
Name ACSS2 Antibody - N-terminal region (ARP61137_P050)
Protein Size (# AA) 606 amino acids
Molecular Weight 66kDa
NCBI Gene Id 55902
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Acyl-CoA synthetase short-chain family member 2
Alias Symbols ACS, ACSA, ACAS2, ACECS, AceCS1, dJ1161H23.1
Peptide Sequence Synthetic peptide located within the following region: NICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants.
Protein Interactions UPF1; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ACSS2 (ARP61137_P050) antibody
Blocking Peptide For anti-ACSS2 (ARP61137_P050) antibody is Catalog # AAP61137 (Previous Catalog # AAPP47292)
Uniprot ID Q4G0E8
Protein Name ACSS2 protein EMBL AAH98422.1
Protein Accession # NP_001229322
Purification Affinity Purified
Nucleotide Accession # NM_001242393
Tested Species Reactivity Human
Gene Symbol ACSS2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Human HT1080
WB Suggested Anti-ACSS2 Antibody
Titration: 1.0 ug/ml
Positive Control: HT1080 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com