Product Number |
ARP61137_P050 |
Product Page |
www.avivasysbio.com/acss2-antibody-n-terminal-region-arp61137-p050.html |
Name |
ACSS2 Antibody - N-terminal region (ARP61137_P050) |
Protein Size (# AA) |
606 amino acids |
Molecular Weight |
66kDa |
NCBI Gene Id |
55902 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Acyl-CoA synthetase short-chain family member 2 |
Alias Symbols |
ACS, ACSA, ACAS2, ACECS, AceCS1, dJ1161H23.1 |
Peptide Sequence |
Synthetic peptide located within the following region: NICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. |
Protein Interactions |
UPF1; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ACSS2 (ARP61137_P050) antibody |
Blocking Peptide |
For anti-ACSS2 (ARP61137_P050) antibody is Catalog # AAP61137 (Previous Catalog # AAPP47292) |
Uniprot ID |
Q4G0E8 |
Protein Name |
ACSS2 protein EMBL AAH98422.1 |
Protein Accession # |
NP_001229322 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001242393 |
Tested Species Reactivity |
Human |
Gene Symbol |
ACSS2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human HT1080
| WB Suggested Anti-ACSS2 Antibody Titration: 1.0 ug/ml Positive Control: HT1080 Whole Cell |
|
|