| Product Number |
ARP60776_P050 |
| Product Page |
www.avivasysbio.com/tarp-antibody-n-terminal-region-arp60776-p050.html |
| Name |
TARP Antibody - N-terminal region (ARP60776_P050) |
| Protein Size (# AA) |
111 amino acids |
| Molecular Weight |
13kDa |
| NCBI Gene Id |
445347 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TCR gamma alternate reading frame protein |
| Alias Symbols |
CD3G, TCRG, TCRGV, TCRGC1, TCRGC2 |
| Peptide Sequence |
Synthetic peptide located within the following region: YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
In some non-lymphoid tissues, the unrearranged T cell receptor gamma (TRG@) locus is expressed. The resulting transcript contains a subset of the TRG@ gene segments and is shorter than TRG@ transcripts expressed in lymphoid tissues. This RefSeq record represents the unrearranged TRG@ locus transcript; the complete TRG@ locus is represented by the genomic RefSeq NG_001336. The transcript represented by this RefSeq has two open reading frames (ORFs) that encode different proteins. The downstream ORF is in the same frame as TRG@ and its protein product is similar to TRG@ proteins. The upstream ORF uses a different reading frame and encodes a novel protein. |
| Protein Interactions |
APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for ARP60776_P050 |
| Blocking Peptide |
Catalog # AAP60776 (Previous Catalog # AAPP46965) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TARP |
| Uniprot ID |
Q0VGM3 |
| Protein Name |
TARP protein EMBL AAI05590.1 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that TARP is expressed in Jurkat |
| Protein Accession # |
NP_001003806 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001003806 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TARP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TARP Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that TARP is expressed in Jurkat |
|
|
