CTAG1B Antibody - C-terminal region (ARP60762_P050)

Data Sheet
 
Product Number ARP60762_P050
Product Page www.avivasysbio.com/ctag1b-antibody-c-terminal-region-arp60762-p050.html
Name CTAG1B Antibody - C-terminal region (ARP60762_P050)
Protein Size (# AA) 180 amino acids
Molecular Weight 18kDa
NCBI Gene Id 1485
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cancer/testis antigen 1B
Alias Symbols CTAG, ESO1, CT6.1, CTAG1, LAGE-2, LAGE2B, NY-ESO-1
Peptide Sequence Synthetic peptide located within the following region: NILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Cancer/testis antigens, such as CTAG1B, are expressed in a variety of malignant tumors but soley in testis among normal adult tissues.
Protein Interactions UBQLN1; UBC; MAGEC1; HLA-DRB4; HLA-DRB3; HLA-DRB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for ARP60762_P050
Blocking Peptide Catalog # AAP60762 (Previous Catalog # AAPP46953)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CTAG1B
Uniprot ID P78358
Protein Name Cancer/testis antigen 1
Protein Accession # NP_001318
Purification Affinity Purified
Nucleotide Accession # NM_001327
Tested Species Reactivity Human
Gene Symbol CTAG1B
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-CTAG1B Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell
Image 2
Human 786-0 Whole Cell
Host: Rabbit
Target Name: CTAG1B
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com