Product Number |
ARP60722_P050 |
Product Page |
www.avivasysbio.com/tmem141-antibody-c-terminal-region-arp60722-p050.html |
Name |
TMEM141 Antibody - C-terminal region (ARP60722_P050) |
Protein Size (# AA) |
108 amino acids |
Molecular Weight |
12kDa |
NCBI Gene Id |
85014 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transmembrane protein 141 |
Alias Symbols |
MGC14141, RP11-216L13.7 |
Peptide Sequence |
Synthetic peptide located within the following region: PLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
NELFE; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for ARP60722_P050 |
Blocking Peptide |
Catalog # AAP60722 (Previous Catalog # AAPP46917) |
Uniprot ID |
Q96I45 |
Protein Name |
Transmembrane protein 141 |
Protein Accession # |
NP_116317 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032928 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEM141 |
Predicted Species Reactivity |
Human, Mouse, Cow |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Human: 100%; Mouse: 91% |
Image 1 | Human Fetal liver
| WB Suggested Anti-TMEM141 Antibody Titration: 1.0 ug/ml Positive Control: Fetal Liver |
|
|