| Product Number |
ARP60599_P050 |
| Product Page |
www.avivasysbio.com/krtap1-5-antibody-c-terminal-region-arp60599-p050.html |
| Name |
KRTAP1-5 Antibody - C-terminal region (ARP60599_P050) |
| Protein Size (# AA) |
174 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
83895 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Keratin associated protein 1-5 |
| Alias Symbols |
KAP1.5, KRTAP1.5 |
| Peptide Sequence |
Synthetic peptide located within the following region: TGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for ARP60599_P050 |
| Blocking Peptide |
Catalog # AAP60599 (Previous Catalog # AAPP46890) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KRTAP1-5 |
| Uniprot ID |
Q9BYS1 |
| Protein Name |
Keratin-associated protein 1-5 |
| Protein Accession # |
NP_114163 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_031957 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KRTAP1-5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Goat: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 92%; Sheep: 92% |
| Image 1 | Human Fetal Brain
 | WB Suggested Anti-KRTAP1-5 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Brain |
|
|
