| Product Number |
ARP60229_P050 |
| Product Page |
www.avivasysbio.com/bcam-antibody-c-terminal-region-arp60229-p050.html |
| Name |
BCAM Antibody - C-terminal region (ARP60229_P050) |
| Protein Size (# AA) |
628 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
4059 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Basal cell adhesion molecule (Lutheran blood group) |
| Alias Symbols |
AU, LU, CD239, MSK19 |
| Peptide Sequence |
Synthetic peptide located within the following region: ADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. |
| Protein Interactions |
KLHL2; SUMO1; UBE2I; UBC; LAMA5; EPB41; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BCAM (ARP60229_P050) antibody |
| Blocking Peptide |
For anti-BCAM (ARP60229_P050) antibody is Catalog # AAP60229 (Previous Catalog # AAPP46433) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human BCAM |
| Uniprot ID |
P50895 |
| Protein Name |
Basal cell adhesion molecule |
| Sample Type Confirmation |
BCAM is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_005572 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005581 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BCAM |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 86%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 83%; Rabbit: 86%; Rat: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-BCAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateBCAM is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
|
