| Product Number |
ARP59911_P050 |
| Product Page |
www.avivasysbio.com/opn1sw-antibody-c-terminal-region-arp59911-p050.html |
| Name |
OPN1SW Antibody - C-terminal region (ARP59911_P050) |
| Protein Size (# AA) |
348 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
611 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Opsin 1 (cone pigments), short-wave-sensitive |
| Description |
|
| Alias Symbols |
BCP, BOP, CBT |
| Peptide Sequence |
Synthetic peptide located within the following region: SESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAERE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene belongs to the G-protein coupled receptor 1 family, opsin subfamily. It encodes the blue cone pigment gene which is one of three types of cone photoreceptors responsible for normal color vision. Defects in this gene are the cause of tritan color blindness (tritanopia). Affected individuals lack blue and yellow sensory mechanisms while retaining those for red and green. Defective blue vision is characteristic. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-OPN1SW (ARP59911_P050) antibody |
| Blocking Peptide |
For anti-OPN1SW (ARP59911_P050) antibody is Catalog # AAP59911 (Previous Catalog # AAPP46066) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human OPN1SW |
| Uniprot ID |
P03999 |
| Protein Name |
Short-wave-sensitive opsin 1 |
| Sample Type Confirmation |
OPN1SW is supported by BioGPS gene expression data to be expressed in A549 |
| Protein Accession # |
NP_001699 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001708 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
OPN1SW |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human A549
 | WB Suggested Anti-OPN1SW Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: A549 cell lysateOPN1SW is supported by BioGPS gene expression data to be expressed in A549 |
|
|
