OR2T29 Antibody - C-terminal region (ARP59826_P050)

Data Sheet
 
Product Number ARP59826_P050
Product Page www.avivasysbio.com/or2t29-antibody-c-terminal-region-arp59826-p050.html
Name OR2T29 Antibody - C-terminal region (ARP59826_P050)
Protein Size (# AA) 309 amino acids
Molecular Weight 35kDa
NCBI Gene Id 343563
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Olfactory receptor, family 2, subfamily T, member 29
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OR2T29 (ARP59826_P050) antibody
Blocking Peptide For anti-OR2T29 (ARP59826_P050) antibody is Catalog # AAP59826 (Previous Catalog # AAPP45984)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR2T29
Uniprot ID Q8NH02
Protein Name Olfactory receptor 2T29
Protein Accession # NP_001004694
Purification Affinity Purified
Nucleotide Accession # NM_001004694
Tested Species Reactivity Human
Gene Symbol OR2T29
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Lung
WB Suggested Anti-OR2T29 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com