| Product Number |
ARP59815_P050 |
| Product Page |
www.avivasysbio.com/dnajc19-antibody-c-terminal-region-arp59815-p050.html |
| Name |
DNAJC19 Antibody - C-terminal region (ARP59815_P050) |
| Protein Size (# AA) |
116 amino acids |
| Molecular Weight |
13kDa |
| Subunit |
TIM14 |
| NCBI Gene Id |
131118 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DnaJ (Hsp40) homolog, subfamily C, member 19 |
| Alias Symbols |
PAM18, TIM14, TIMM14 |
| Peptide Sequence |
Synthetic peptide located within the following region: LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Several transcript variants, some protein-coding and some not, have been found for this gene. |
| Protein Interactions |
SLTM; SFPQ; HSPA5; HSPA1L; APP; HSPA9; UBC; PAM16; TIMM17A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DNAJC19 (ARP59815_P050) antibody |
| Blocking Peptide |
For anti-DNAJC19 (ARP59815_P050) antibody is Catalog # AAP59815 (Previous Catalog # AAPP45974) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DNAJC19 |
| Uniprot ID |
Q96DA6 |
| Protein Name |
Mitochondrial import inner membrane translocase subunit TIM14 |
| Protein Accession # |
NP_660304 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145261 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DNAJC19 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93% |
| Image 1 | Human Placenta
 | WB Suggested Anti-DNAJC19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta |
|
|
