MANF Antibody - C-terminal region (ARP59608_P050)

• Product Number: ARP59608_P050
• Name: MANF Antibody - C-terminal region (ARP59608_P050)
• Protein Size (# AA): 185 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 7873
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mesencephalic astrocyte-derived neurotrophic factor
• Alias Symbols: ARP, ARMET
• Peptide Sequence: Synthetic peptide located within the following region: EKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: MANF is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of MANF gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of polymorphisms in the arginine-rich region, including a specific mutation that changes the previously numbered codon 50 from ATG to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus not tumor-related.
• Protein Interactions: UBC; MDM2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MANF (ARP59608_P050) antibody is Catalog # AAP59608 (Previous Catalog # AAPP46308)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MANF
• Uniprot ID: A8K878
• Protein Name: cDNA FLJ77177, highly similar to Homo sapiens arginine-rich, mutated in early stage tumors (ARMET), mRNA EMBL BAF84932.1
• Sample Type Confirmation:

  MANF is supported by BioGPS gene expression data to be expressed in HCT15

• Protein Accession #: NP_006001
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006010
• Tested Species Reactivity: Human
• Gene Symbol: MANF
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human HCT15
  
  WB Suggested Anti-MANF Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HCT15 cell lysateMANF is supported by BioGPS gene expression data to be expressed in HCT15