website statistics
Product Datasheet: ARP59608_P050 - MANF antibody - C-terminal region (ARP59608_P050) - Aviva Systems Biology
 
MANF antibody - C-terminal region (ARP59608_P050)
Data Sheet
 
Product Number ARP59608_P050
Product Page www.avivasysbio.com/manf-antibody-c-terminal-region-arp59608-p050.html
Product Name MANF antibody - C-terminal region (ARP59608_P050)
Size 100 ul
Gene Symbol MANF
Alias Symbols ARMET, ARP, MGC142148, MGC142150
Protein Size (# AA) 185 amino acids
Molecular Weight 21kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 7873
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Mesencephalic astrocyte-derived neurotrophic factor
Description This is a rabbit polyclonal antibody against MANF. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: EKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCK
Description of Target MANF is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of MANF gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of polymorphisms in the arginine-rich region, including a specific mutation that changes the previously numbered codon 50 from ATG to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus not tumor-related.
Protein Interactions UBC; MDM2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-MANF (ARP59608_P050) antibody is Catalog # AAP59608 (Previous Catalog # AAPP46308)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MANF
Complete computational species homology data Anti-MANF (ARP59608_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MANF.
Swissprot Id A8K878
Protein Name cDNA FLJ77177, highly similar to Homo sapiens arginine-rich, mutated in early stage tumors (ARMET), mRNA EMBL BAF84932.1
Sample Type Confirmation

MANF is supported by BioGPS gene expression data to be expressed in HCT15

Protein Accession # NP_006001
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MANF.
Nucleotide Accession # NM_006010
Conjugation Options

ARP59608_P050-FITC Conjugated

ARP59608_P050-HRP Conjugated

ARP59608_P050-Biotin Conjugated

Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HCT15
WB Suggested Anti-MANF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HCT15 cell lysate

MANF is supported by BioGPS gene expression data to be expressed in HCT15

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com