Product Number |
ARP59585_P050 |
Product Page |
www.avivasysbio.com/coch-antibody-n-terminal-region-arp59585-p050.html |
Name |
COCH Antibody - N-terminal region (ARP59585_P050) |
Protein Size (# AA) |
550 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
1690 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Coagulation factor C homolog, cochlin (Limulus polyphemus) |
Alias Symbols |
DFNA9, COCH5B2, DFNB110, COCH-5B2 |
Peptide Sequence |
Synthetic peptide located within the following region: AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene is highly conserved in human, mouse, and chicken, showing 94% and 79% amino acid identity of human to mouse and chicken sequences, respectively. Hybridization to this gene was detected in spindle-shaped cells located along nerve fibers between the auditory ganglion and sensory epithelium. These cells accompany neurites at the habenula perforata, the opening through which neurites extend to innervate hair cells. This and the pattern of expression of this gene in chicken inner ear paralleled the histologic findings of acidophilic deposits, consistent with mucopolysaccharide ground substance, in temporal bones from DFNA9 (autosomal dominant nonsyndromic sensorineural deafness 9) patients. Mutations that cause DFNA9 have been reported in this gene. Alternative splicing results in multiple transcript variants encoding the same protein. Additional splice variants encoding distinct isoforms have been described but their biological validities have not been demonstrated. |
Protein Interactions |
FBXO6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-COCH (ARP59585_P050) antibody |
Blocking Peptide |
For anti-COCH (ARP59585_P050) antibody is Catalog # AAP59585 (Previous Catalog # AAPP45390) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human COCH |
Uniprot ID |
O43405 |
Protein Name |
Cochlin |
Protein Accession # |
NP_001128530 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001135058 |
Tested Species Reactivity |
Human |
Gene Symbol |
COCH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Placenta
| WB Suggested Anti-COCH Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Placenta |
|
|