COCH Antibody - N-terminal region (ARP59585_P050)

Data Sheet
 
Product Number ARP59585_P050
Product Page www.avivasysbio.com/coch-antibody-n-terminal-region-arp59585-p050.html
Name COCH Antibody - N-terminal region (ARP59585_P050)
Protein Size (# AA) 550 amino acids
Molecular Weight 57kDa
NCBI Gene Id 1690
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Coagulation factor C homolog, cochlin (Limulus polyphemus)
Alias Symbols DFNA9, COCH5B2, DFNB110, COCH-5B2
Peptide Sequence Synthetic peptide located within the following region: AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is highly conserved in human, mouse, and chicken, showing 94% and 79% amino acid identity of human to mouse and chicken sequences, respectively. Hybridization to this gene was detected in spindle-shaped cells located along nerve fibers between the auditory ganglion and sensory epithelium. These cells accompany neurites at the habenula perforata, the opening through which neurites extend to innervate hair cells. This and the pattern of expression of this gene in chicken inner ear paralleled the histologic findings of acidophilic deposits, consistent with mucopolysaccharide ground substance, in temporal bones from DFNA9 (autosomal dominant nonsyndromic sensorineural deafness 9) patients. Mutations that cause DFNA9 have been reported in this gene. Alternative splicing results in multiple transcript variants encoding the same protein. Additional splice variants encoding distinct isoforms have been described but their biological validities have not been demonstrated.
Protein Interactions FBXO6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-COCH (ARP59585_P050) antibody
Blocking Peptide For anti-COCH (ARP59585_P050) antibody is Catalog # AAP59585 (Previous Catalog # AAPP45390)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COCH
Uniprot ID O43405
Protein Name Cochlin
Protein Accession # NP_001128530
Purification Affinity Purified
Nucleotide Accession # NM_001135058
Tested Species Reactivity Human
Gene Symbol COCH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Placenta
WB Suggested Anti-COCH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com