AVPR2 Antibody - C-terminal region (ARP59538_P050)

• Product Number: ARP59538_P050
• Name: AVPR2 Antibody - C-terminal region (ARP59538_P050)
• Protein Size (# AA): 371 amino acids
• Molecular Weight: 40 kDa
• NCBI Gene Id: 554
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Arginine vasopressin receptor 2
• Alias Symbols: DI1, DIR, NDI, V2R, ADHR, DIR3
• Peptide Sequence: Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes the vasopressin receptor, type 2, also known as the V2 receptor, which belongs to the seven-transmembrane-domain G protein-coupled receptor (GPCR) superfamily, and couples to Gs thus stimulating adenylate cyclase. The subfamily that includes the V2 receptor, the V1a and V1b vasopressin receptors, the oxytocin receptor, and isotocin and mesotocin receptors in non-mammals, is well conserved, though several members signal via other G proteins. All bind similar cyclic nonapeptide hormones. The V2 receptor is expressed in the kidney tubule, predominantly in the distal convoluted tubule and collecting ducts, where its primary property is to respond to the pituitary hormone arginine vasopressin (AVP) by stimulating mechanisms that concentrate the urine and maintain water homeostasis in the organism. When the function of this gene is lost, the disease Nephrogenic Diabetes Insipidus (NDI) results. The V2 receptor is also expressed outside the kidney although its tissue localization is uncertain. When these 'extrarenal receptors' are stimulated by infusion of a V2 selective agonist (dDAVP), a variety of clotting factors are released into the bloodstream. The physiologic importance of this property is not known - its absence does not appear to be detrimental in NDI patients. The gene expression has also been described in fetal lung tissue and lung cancer associated with alternative splicing.
• Protein Interactions: ARRDC4; ARRDC3; GNG2; GNB1; GNAS; STUB1; UBC; DERL1; VCP; C1QTNF1; GRK5; AVP; ARRB2; MAPK3; PRKCA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-AVPR2 (ARP59538_P050) antibody is Catalog # AAP59538 (Previous Catalog # AAPP45381)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AVPR2
• Uniprot ID: P30518
• Protein Name: Vasopressin V2 receptor
• Protein Accession #: NP_000045
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000054
• Tested Species Reactivity: Human
• Gene Symbol: AVPR2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Sheep: 79%
• Image 1: THP-1, A549
  
  Host: Rabbit
  Target: AVPR2
  Positive control (+): THP-1 (N30)
  Negative control (-): A549 (N03)
  Antibody concentration: 1ug/ml
• Image 2: Human HeLa
  
  WB Suggested Anti-AVPR2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Hela cell lysate
• Image 3: Human Fetal Lung
  
  Host: Rabbit
  Target Name: AVPR2
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml