POFUT1 Antibody - middle region (ARP59441_P050)

Data Sheet
 
Product Number ARP59441_P050
Product Page www.avivasysbio.com/pofut1-antibody-middle-region-arp59441-p050.html
Name POFUT1 Antibody - middle region (ARP59441_P050)
Protein Size (# AA) 388 amino acids
Molecular Weight 41kDa
NCBI Gene Id 23509
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein O-fucosyltransferase 1
Alias Symbols DDD2, FUT12, O-FUT, OFUCT1, O-Fuc-T, O-FucT-1
Peptide Sequence Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Protein Interactions UBC; NEDD8; FBXO6; AKT2; NNT; H2AFX; DLL1; JAG1; NOTCH1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-POFUT1 (ARP59441_P050) antibody
Blocking Peptide For anti-POFUT1 (ARP59441_P050) antibody is Catalog # AAP59441 (Previous Catalog # AAPP45376)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human POFUT1
Uniprot ID Q6EV69
Protein Name GDP-fucose protein O-fucosyltransferase 1
Sample Type Confirmation

POFUT1 is strongly supported by BioGPS gene expression data to be expressed in PANC1

Protein Accession # NP_056167
Purification Affinity Purified
Nucleotide Accession # NM_015352
Tested Species Reactivity Human
Gene Symbol POFUT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human PANC1
WB Suggested Anti-POFUT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysatePOFUT1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com