Product Number |
ARP59441_P050 |
Product Page |
www.avivasysbio.com/pofut1-antibody-middle-region-arp59441-p050.html |
Name |
POFUT1 Antibody - middle region (ARP59441_P050) |
Protein Size (# AA) |
388 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
23509 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Protein O-fucosyltransferase 1 |
Alias Symbols |
DDD2, FUT12, O-FUT, OFUCT1, O-Fuc-T, O-FucT-1 |
Peptide Sequence |
Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. |
Protein Interactions |
UBC; NEDD8; FBXO6; AKT2; NNT; H2AFX; DLL1; JAG1; NOTCH1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-POFUT1 (ARP59441_P050) antibody |
Blocking Peptide |
For anti-POFUT1 (ARP59441_P050) antibody is Catalog # AAP59441 (Previous Catalog # AAPP45376) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human POFUT1 |
Uniprot ID |
Q6EV69 |
Protein Name |
GDP-fucose protein O-fucosyltransferase 1 |
Sample Type Confirmation |
POFUT1 is strongly supported by BioGPS gene expression data to be expressed in PANC1 |
Protein Accession # |
NP_056167 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015352 |
Tested Species Reactivity |
Human |
Gene Symbol |
POFUT1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human PANC1
| WB Suggested Anti-POFUT1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: PANC1 cell lysatePOFUT1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells |
|