| Product Number |
ARP59252_P050 |
| Product Page |
www.avivasysbio.com/serpinb8-antibody-c-terminal-region-arp59252-p050.html |
| Name |
SERPINB8 Antibody - C-terminal region (ARP59252_P050) |
| Protein Size (# AA) |
242 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
5271 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Serpin peptidase inhibitor, clade B (ovalbumin), member 8 |
| Alias Symbols |
PI8, CAP2, PI-8, PSS5, C18orf53 |
| Peptide Sequence |
Synthetic peptide located within the following region: LVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. Serpins are characterized by well-conserved a tertiary structure that consists of 3 beta sheets and 8 or 9 alpha helices (Huber and Carrell, 1989 [PubMed 2690952]). A critical portion of the molecule, the reactive center loop connects beta sheets A and C. Protease inhibitor-8 (PI8; SERPINB8) is a member of the ov-serpin subfamily, which, relative to the archetypal serpin PI1 (MIM 107400), is characterized by a high degree of homology to chicken ovalbumin, lack of N- and C-terminal extensions, absence of a signal peptide, and a serine rather than an asparagine residue at the penultimate position (summary by Bartuski et al., 1997 [PubMed 9268635]). |
| Protein Interactions |
SUMO2; LARS; UBC; CAP1; PRSS1; F10; F2; FURIN; BCL2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SERPINB8 (ARP59252_P050) antibody |
| Blocking Peptide |
For anti-SERPINB8 (ARP59252_P050) antibody is Catalog # AAP59252 (Previous Catalog # AAPP45241) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINB8 |
| Uniprot ID |
Q8N178 |
| Protein Name |
Serpin B8 |
| Protein Accession # |
NP_001027018 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001031848 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SERPINB8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SERPINB8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
