| Product Number |
ARP59251_P050 |
| Product Page |
www.avivasysbio.com/serpinb7-antibody-n-terminal-region-arp59251-p050.html |
| Name |
SERPINB7 Antibody - N-terminal region (ARP59251_P050) |
| Protein Size (# AA) |
380 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
8710 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Serpin peptidase inhibitor, clade B (ovalbumin), member 7 |
| Alias Symbols |
PPKN, TP55, MEGSIN |
| Peptide Sequence |
Synthetic peptide located within the following region: LSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
SERPINB7 might function as an inhibitor of Lys-specific proteases. SERPINB7 might influence the maturation of megakaryocytes via its action as a serpin. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SERPINB7 (ARP59251_P050) antibody |
| Blocking Peptide |
For anti-SERPINB7 (ARP59251_P050) antibody is Catalog # AAP59251 (Previous Catalog # AAPP45240) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINB7 |
| Uniprot ID |
O75635 |
| Protein Name |
Serpin B7 |
| Protein Accession # |
NP_003775 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003784 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SERPINB7 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human PANC1
 | WB Suggested Anti-SERPINB7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate |
|
|
