| Product Number |
ARP59117_P050 |
| Product Page |
www.avivasysbio.com/izumo1r-antibody-middle-region-arp59117-p050.html |
| Name |
IZUMO1R Antibody - middle region (ARP59117_P050) |
| Protein Size (# AA) |
243 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
390243 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
IZUMO1 receptor, JUNO |
| Alias Symbols |
JUNO, FOLR4, Folbp3, FR-delta |
| Peptide Sequence |
Synthetic peptide located within the following region: TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IZUMO1R (ARP59117_P050) antibody |
| Blocking Peptide |
For anti-IZUMO1R (ARP59117_P050) antibody is Catalog # AAP59117 (Previous Catalog # AAPP45329) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FOLR4 |
| Uniprot ID |
C9JJV3 |
| Protein Name |
sperm-egg fusion protein Juno |
| Protein Accession # |
NP_001073955 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001080486 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IZUMO1R |
| Predicted Species Reactivity |
Human, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 85%; Horse: 90%; Human: 100% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-FOLR4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate |
|
|
