| Product Number |
ARP58819_P050 |
| Product Page |
www.avivasysbio.com/wnt3a-antibody-c-terminal-region-arp58819-p050.html |
| Name |
Wnt3a Antibody - C-terminal region (ARP58819_P050) |
| Protein Size (# AA) |
352 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
22416 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Wingless-related MMTV integration site 3A |
| Alias Symbols |
vt, Wnt-, Wnt-3a |
| Peptide Sequence |
Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. |
| Protein Interactions |
Wnt1; Porcn; Cdh2; Sfrp4; Frzb; Sfrp1; Sfrp2; Ryk; Dkk1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Wnt3a (ARP58819_P050) antibody |
| Additional Information |
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 2.5 ug/ml. |
| Blocking Peptide |
For anti-Wnt3a (ARP58819_P050) antibody is Catalog # AAP58819 (Previous Catalog # AAPP38637) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P27467 |
| Protein Name |
Protein Wnt-3a |
| Protein Accession # |
NP_033548 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009522 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Wnt3a |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 75% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Wnt3a Antibody Titration: 1 ug/ml
Positive Control: Mouse Heart lysate |
|
| Image 2 | Human Placenta
 | Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:500 using anti-Wnt3a antibody (ARP58819_P050) |
|
| Image 3 | Mouse Heart
 | Host: Rabbit
Target Name: Wnt3a
Sample Type: Mouse Heart
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5ug/ml
Lysate Quantity: 25ug/lane
Gel Concentration: 0.12% |
|
| Image 4 |
 | Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
|
