| Product Number |
ARP58727_P050 |
| Product Page |
www.avivasysbio.com/tpd52l3-antibody-middle-region-arp58727-p050.html |
| Name |
TPD52L3 Antibody - middle region (ARP58727_P050) |
| Protein Size (# AA) |
136 amino acids |
| Molecular Weight |
15kDa |
| NCBI Gene Id |
89882 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tumor protein D52-like 3 |
| Alias Symbols |
D55, hD55, TPD55, NYDSP25 |
| Peptide Sequence |
Synthetic peptide located within the following region: GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cao,Q., (2006) Biochem. Biophys. Res. Commun. 344 (3), 798-806 |
| Description of Target |
The exact functions of TPD52L3 remain unknown. |
| Protein Interactions |
AGTRAP; CMTM5; APP; TPD52L3; TPD52L2; NFIC; TPD52L1; TPD52; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TPD52L3 (ARP58727_P050) antibody |
| Blocking Peptide |
For anti-TPD52L3 (ARP58727_P050) antibody is Catalog # AAP58727 (Previous Catalog # AAPP36423) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TPD52L3 |
| Uniprot ID |
Q96J77-2 |
| Protein Name |
Tumor protein D55 |
| Protein Accession # |
NP_001001874 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001001874 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TPD52L3 |
| Predicted Species Reactivity |
Human, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Horse: 79%; Human: 93%; Rabbit: 79% |
| Image 1 | Human 293T
 | WB Suggested Anti-TPD52L3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate |
|
|
