LYPLA2 Antibody - N-terminal region (ARP58638_P050)

• Product Number: ARP58638_P050
• Name: LYPLA2 Antibody - N-terminal region (ARP58638_P050)
• Protein Size (# AA): 231 amino acids
• Molecular Weight: 25kDa
• NCBI Gene Id: 11313
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Lysophospholipase II
• Alias Symbols: APT2, APT-2, DJ886K2.4
• Peptide Sequence: Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72
• Description of Target: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
• Protein Interactions: UBC; VCAM1; ITGA4; APP; MED31; SCMH1; DKC1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LYPLA2 (ARP58638_P050) antibody is Catalog # AAP58638 (Previous Catalog # AAPP35775)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2
• Uniprot ID: O95372
• Protein Name: Acyl-protein thioesterase 2
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that LYPLA2 is expressed in HEK293T

• Protein Accession #: NP_009191
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007260
• Tested Species Reactivity: Human
• Gene Symbol: LYPLA2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Adult Liver
  
  Rabbit Anti-LYPLA2 Antibody
  Catalog Number: ARP58638_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 2: Human 293T
  
  WB Suggested Anti-LYPLA2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that LYPLA2 is expressed in HEK293T