Product Number |
ARP58637_P050 |
Product Page |
www.avivasysbio.com/lypd4-antibody-n-terminal-region-arp58637-p050.html |
Name |
LYPD4 Antibody - N-terminal region (ARP58637_P050) |
Protein Size (# AA) |
246 amino acids |
Molecular Weight |
27kDa |
NCBI Gene Id |
147719 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
LY6/PLAUR domain containing 4 |
Alias Symbols |
SMR |
Peptide Sequence |
Synthetic peptide located within the following region: MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
The specific function of LYPD4 is not yet known. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LYPD4 (ARP58637_P050) antibody |
Blocking Peptide |
For anti-LYPD4 (ARP58637_P050) antibody is Catalog # AAP58637 (Previous Catalog # AAPP35774) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LYPD4 |
Uniprot ID |
Q6UWN0 |
Protein Name |
Ly6/PLAUR domain-containing protein 4 |
Protein Accession # |
NP_775777 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_173506 |
Tested Species Reactivity |
Human |
Gene Symbol |
LYPD4 |
Predicted Species Reactivity |
Human, Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 79%; Rat: 79% |
Image 1 | Human 721_B
| WB Suggested Anti-LYPD4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 721_B cell lysate |
|
|