GPX4 Antibody - middle region (ARP58473_P050)

• Product Number: ARP58473_P050
• Name: GPX4 Antibody - middle region (ARP58473_P050)
• Protein Size (# AA): 197 amino acids
• Molecular Weight: 19 kDa
• NCBI Gene Id: 2879
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutathione peroxidase 4
• Alias Symbols: MCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx
• Peptide Sequence: Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154
• Description of Target: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
• Protein Interactions: UBC; PRDX6; MAPK13; OTUD5;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Additional Information: IHC Information: Human heart (formalin-fixed, paraffin-embedded) stained with GPX4 antibody ARP58473_P050 at 5 ug/ml after heat-induced antigen retrieval
• Blocking Peptide: For anti-GPX4 (ARP58473_P050) antibody is Catalog # AAP58473 (Previous Catalog # AAPP34569)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPX4
• Uniprot ID: P36969
• Protein Name: Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
• Sample Type Confirmation:

  GPX4 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_002076
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002085
• Tested Species Reactivity: Human, Rat
• Gene Symbol: GPX4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Goat: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rat: 86%; Yeast: 93%; Zebrafish: 86%
• Image 1: Human HepG2
  
  GPX4 antibody - middle region (ARP58473_P050) validated by WB using HepG2 cell lysate at 1.0ug/ml.GPX4 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 2: Human Heart
  
  Immunohistochemistry with formalin-fixed, paraffin-embedded human Heart tissue at an antibody concentration of 5.0ug/ml using anti-GPX4 antibody (ARP58473_P050)
• Image 3: Rat Brain
  
  Immunohistochemistry with Rat Brain lysate tissue